Recombinant Mouse CXCL9/MIG Protein
Product Sizes
10 ug
£145.00
RP02851-10UG
20 ug
£193.00
RP02851-20UG
50 ug
£288.00
RP02851-50UG
About this Product
- SKU:
- RP02851
- Additional Names:
- Mig|Scyb9
- Extra Details:
- Recombinant Mouse CXCL9/MIG Protein is produced by Pichia expression system. The target protein is expressed with sequence (Thr 22-Thr 126) of mouse CXCL9/MIG (Accession #NP_032625.2) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from sterile PBS, pH 7.4
- Immunogen:
- Thr 22-Thr 126
- Molecular Weight:
- 13.14 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANV KKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02851
