Recombinant Mouse CXCL9/MIG Protein
Product Sizes
10 ug
£145.00
RP02851-10UG
20 ug
£193.00
RP02851-20UG
50 ug
£288.00
RP02851-50UG
500 ug
£1240.00
RP02851-500UG
1000 ug
£1954.00
RP02851-1000UG
About this Product
- SKU:
- RP02851
- Additional Names:
- Mig|Scyb9
- Extra Details:
- Chemokine (C-X-C motif) ligand 9 (CXCL9), also known as Monokine induced by gamma interferon (MIG), is a small cytokine belonging to the CXC chemokine family. The function of this chemokine has not been specifically defined; however, it is thought to be involved in T cell trafficking. CXCL9/MIG functions as one of the three ligands of chemokine receptor CXCR3 which is a G protein-coupled receptor found predominantly on T cells. CXCL9/MIG, together with CXCL10 and CXCL11, may activate CXCR3 by binding to it. CXCL9 serves as a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. It has been observed that tumour endothelial cells secrete high levels of CXCL9 in all, and CXCL10 in most melanoma metastases. Experiment data represent novel mechanisms by which tumour cells in melanoma metastases might use the chemokine-expressing endothelium to leave the tumour and eventually to form additional metastases at distinct sites. Experiment results also improved that CXCL9/MIG plays an important role in CD4+ T lymphocyte recruitment and development of CAV, MOMA-2+ macrophages are the predominant recipient-derived source of CXCL9/MIG, and recipient CD4 lymphocytes are necessary for sustained CXCL9/MIG production and CAV development in this model. Neutralization of the chemokine CXCL9/MIG may have therapeutic potential for the treatment of chronic rejection after heart transplantation.
- Formulation:
- Recombinant Mouse CXCL9/MIG Protein is produced by Pichia expression system. The target protein is expressed with sequence (Thr 22-Thr 126) of mouse CXCL9/MIG (Accession #NP_032625.2) fused with a His
- Immunogen:
- Thr 22-Thr 126
- Molecular Weight:
- 12-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANV KKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02851
