Recombinant Mouse Sclerostin/SOST Protein
Product Sizes
10 ug
£193.00
RP02845-10UG
50 ug
£383.00
RP02845-50UG
100 ug
£586.00
RP02845-100UG
About this Product
- SKU:
- RP02845
- Additional Names:
- SOST,CDD,DAND6,SOST1,VBCH
- Extra Details:
- Recombinant Mouse Sclerostin/SOST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Tyr211) of mouse Sclerostin/SOST (Accession #NP_077769.4) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln24-Tyr211
- Molecular Weight:
- 21.97 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02845
