Recombinant Mouse L-Selectin/SELL/CD62L Protein
Product Sizes
50 ug
£240.00
RP02841-50UG
100 ug
£353.00
RP02841-100UG
About this Product
- SKU:
- RP02841
- Additional Names:
- IPO5, KPNB3, RANBP5,L-selectin, CD62L
- Extra Details:
- Recombinant Mouse L-Selectin/SELL/CD62L Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Met1-Asn332) of Mouse L-Selectin/SELL/CD62L (Accession #NP_035476.1) fused with His tag at the C-Terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4).
- Immunogen:
- Asp29-Asn332
- Molecular Weight:
- 33.92 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- DFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP02841
