Recombinant Human CXCL13/BLC Protein
Product Sizes
20 ug
£258.00
RP02839-20UG
100 ug
£556.00
RP02839-100UG
About this Product
- SKU:
- RP02839
- Additional Names:
- ANGIE|ANGIE2|BCA-1|BCA1|BLC|BLR1L|CXCL13|SCYB13
- Extra Details:
- Recombinant Human CXCL13/BLC Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val23-Arg94) of human CXCL13/BLC (Accession #NP_006410.1) fused with no additional amino acid.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50 mM Tris, 0.5 M NaCl, pH 7.5.
- Immunogen:
- Val23-Arg94
- Molecular Weight:
- 8.8 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02839
