Recombinant Human CXCL13/BLC Protein
Product Sizes
20 ug
£258.00
RP02839-20UG
100 ug
£556.00
RP02839-100UG
About this Product
- SKU:
- RP02839
- Additional Names:
- ANGIE|ANGIE2|BCA-1|BCA1|BLC|BLR1L|CXCL13|SCYB13
- Extra Details:
- The chemokine CXCL13, also known as BCA-1 (B-cell-attracting chemokine-1) or BLC (B-lymphocyte chemoattractant), which belongs to the CXC chemokine family. CXCL13 and its receptor CXCR5 control the organization of B cells within follicles of lymphoid tissues. CXCL13 is known to dictate homing and motility of B cells in lymphoid tissue and has been implicated in the formation of ectopic lymphoid tissue in chronic inflammation. It involves in B-cell compartmental homing within secondary lymphoid organs and recently implicated in the pathogenesis of inflammatory and malignant lymphocyte-mediated diseases. In Primary central nervous system lymphoma (PCNSL), expression of BCA-1 by malignant lymphocytes and vascular endothelium may influence tumor development and localization to central nervous system (CNS). In T-lymphocytes, CXCL13 expression is thought to reflect a germinal center origin of the T-cell. CXCL13 expression may also provide an additional useful tool for the diagnosis of Angioimmunoblastic T-cell lymphoma (AITL).
- Formulation:
- Recombinant Human CXCL13/BLC Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val23-Arg94) of human CXCL13/BLC (Accession #NP_006410.1) fused with no ad
- Immunogen:
- Val23-Arg94
- Molecular Weight:
- 8-10 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02839
