Recombinant Human Glycophorin-A/GYPA/CD235a protein
Product Sizes
10 ug
£145.00
RP02835-10UG
20 ug
£193.00
RP02835-20UG
50 ug
£264.00
RP02835-50UG
100 ug
£395.00
RP02835-100UG
500 ug
£1157.00
RP02835-500UG
1000 ug
£1812.00
RP02835-1000UG
About this Product
- SKU:
- RP02835
- Additional Names:
- CD235a|GPA|GPErik|GpMiIII|GPSAT|GYPA|HGpMiIII|HGpMiV|HGpMiX|HGpMiXI|HGpSta(C)|MN|MNS|PAS-2
- Extra Details:
- Granulomatosis with polyangiitis (GPA) presents a wide spectrum of manifestations from the common respiratory symptoms to infrequent neurological and cardiac complications. The challenge in diagnosis and management makes the rapidly progressive disorder one of the most challenging dilemmas in clinical medicine.The ultimate goal is an improved prognosis through outcome measures which assesses the disease control with minimal adverse effects of intensive immunosuppressive regimens, an integral part of the clinical approach to improve the quality of life of GPA patients.
- Formulation:
- Recombinant Human Glycophorin-A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Glu91) of human Glycophorin-A (Accession #NP_002090.4) fused
- Immunogen:
- Leu20-Glu91
- Molecular Weight:
- 45-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02835


