Recombinant Human GPX4 Protein
Product Sizes
100 ug
£621.00
RP02834-100UG
About this Product
- SKU:
- RP02834
- Additional Names:
- GPx-4|GPX4|GSHPx-4|MCSP|PHGPx|SMDS|snGPx|snPHGPx
- Extra Details:
- Recombinant Human GPX4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly26-Phe197,U73C) of human GPX4 (Accession #NP_002076.2) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 150MM NaCl, 50mM Tris, pH 8.0.
- Immunogen:
- Gly26-Phe197,U73C
- Molecular Weight:
- 20.59 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP02834
