Recombinant Human TUBB4A Protein
Product Sizes
10 ug
£193.00
RP02833-10UG
50 ug
£478.00
RP02833-50UG
500 ug
£2192.00
RP02833-500UG
About this Product
- SKU:
- RP02833
- Additional Names:
- TUBB4|TUBB4A|TUBB5|Tubulin 5 Beta|Tubulin Beta-4 Chain|Tubulin Beta-4A Chain
- Extra Details:
- Tubulin Beta-4A Chain (TUBB4A) is a cytoplasmic peptide containing 444 amino acids. TUBB4A is a member of the Tubulin family. Tubulin is the major constituent of microtubules. Tubulin is a dimer composed of one alpha and one beta tubulin molecule; there are many forms of beta tubulins, Beta II and Beta IV Tubulin are ubiquitously expressed. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
- Formulation:
- Recombinant Human TUBB4A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ala444) of human TUBB4A (Accession #NP_006078.2) fused with a 6xHis tag a
- Immunogen:
- Met1-Ala444
- Molecular Weight:
- 58 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02833
