Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein
Product Sizes
10 ug
£193.00
RP02831-10UG
50 ug
£478.00
RP02831-50UG
About this Product
- SKU:
- RP02831
- Additional Names:
- Angiopoietin-like protein 8|Angptl8|Betatrophin|Lipasin
- Extra Details:
- Recombinant Human Angiopoietin-like 8/ANGPTL8(22-198) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala22-Ala198) of human Angiopoietin-like 8/ANGPTL8 (Accession #NP_061157.3) fused with a hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Immunogen:
- Ala22-Ala198
- Molecular Weight:
- 46 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 80 %
- Sequence:
- APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02831
