Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein
Product Sizes
10 ug
£193.00
RP02831-10UG
50 ug
£478.00
RP02831-50UG
500 ug
£2192.00
RP02831-500UG
About this Product
- SKU:
- RP02831
- Additional Names:
- Angiopoietin-like protein 8|Angptl8|Betatrophin|Lipasin
- Extra Details:
- The protein specifically promotes pancreatic beta cell proliferation and beta cell mass expansion, thereby improving glucose tolerance. It promotes pancreatic beta cell proliferation without insulin resistance. Also it acts as a blood lipid regulator by regulating serum triglyceride levels and possibly by promoting ANGPTL3 cleavage. It interacts with ANGPTL3. It predominantly expressed in liver and also expressed in adipose tissues. The ability of the protein to induce pancreatic beta cell proliferation is promising in diabetes therapy. Betatrophin treatment could supply or replace insulin injections by increasing the number of insulin-producing cells in diabetes.
- Formulation:
- Recombinant Human Angiopoietin-like 8/ANGPTL8(22-198) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala22-Ala198) of human Angiopoietin-like 8/A
- Immunogen:
- Ala22-Ala198
- Molecular Weight:
- 54 kda
- Physical State:
- Lyophilized
- Purity:
- ≥ 80 %
- Sequence:
- APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02831
