Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein
Product Sizes
10 ug
£133.00
RP02829-10UG
20 ug
£181.00
RP02829-20UG
50 ug
£240.00
RP02829-50UG
100 ug
£353.00
RP02829-100UG
500 ug
£1002.00
RP02829-500UG
1000 ug
£1574.00
RP02829-1000UG
About this Product
- SKU:
- RP02829
- Additional Names:
- Faslg|FASLG,ALPS1B,APT1LG1,APTL,CD178,CD95-L,CD95L,FASL,TNFSF6,TNLG1A,Fas ligand,FasL,FasLG
- Extra Details:
- Fas Ligand, also known as FASLG and CD95L, is the ligand for FAS. It is a transmembrane protein which binds to TNFRSF6/FAS. Interaction of FAS with fas Ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Fas Ligand may be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.
- Formulation:
- Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro132-Leu279) of mouse Fas ligand/APTL/CD95 ligand/CD17
- Immunogen:
- Pro132-Leu279
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02829
