Recombinant Mouse TNFSF12/TWEAK Protein
Product Sizes
50 ug
£336.00
RP02821-50UG
About this Product
- SKU:
- RP02821
- Additional Names:
- TNFSF12,APO3L,DR3LG,TNLG4A,TWEAK
- Extra Details:
- TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is a ligand for the FN14/TWEAKR receptor. TNFSF12 has overlapping signaling functions with TNF, but displays a much wider tissue distribution. It can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. It is also found that TNFSF12 promotes proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. TNFSF12 also is a weak inducer of apoptosis in some cell types and mediates NF-kappa-B activation.
- Formulation:
- Recombinant Mouse TNFSF12/TWEAK Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Arg105-His249) of mouse TNFSF12/TWEAK (Accession #NP_035744.1) fus
- Immunogen:
- Arg105-His249
- Molecular Weight:
- 20,35,45-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- RAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02821
