Recombinant Mouse Asprosin/Fibrillin-1/FBN1 Protein
Product Sizes
10 ug
£193.00
RP02819-10UG
20 ug
£258.00
RP02819-20UG
50 ug
£383.00
RP02819-50UG
About this Product
- SKU:
- RP02819
- Additional Names:
- Asprosin|Fbn-1|Fbn1|Fibrillin-1
- Extra Details:
- Recombinant Mouse Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2734-His2873) of mouse Fibrillin-1/FBN1 (Accession #AAA56840.1) fused with a 8xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser2734-His2873
- Molecular Weight:
- 16.73 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- STNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:RP02819
