Recombinant Human Lymphotactin/XCL1 Protein
Product Sizes
10 ug
£133.00
RP02815-10UG
20 ug
£181.00
RP02815-20UG
50 ug
£240.00
RP02815-50UG
About this Product
- SKU:
- RP02815
- Additional Names:
- XCL1, LTN, SCYC1,Lymphotactin, ATAC, C motif chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1, XC chemokine ligand 1
- Extra Details:
- Recombinant Human Lymphotactin/XCL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val22-Gly114) of Human Lymphotactin/XCL1 (Accession #NP_002986.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Val22-Gly114
- Molecular Weight:
- 11.11 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02815
