Recombinant Mouse/Rat Flt4 ligand/VEGF-C Protein
Product Sizes
10 ug
£163.00
RP02804-10UG
20 ug
£223.00
RP02804-20UG
50 ug
£336.00
RP02804-50UG
100 ug
£508.00
RP02804-100UG
500 ug
£1478.00
RP02804-500UG
1000 ug
£2335.00
RP02804-1000UG
About this Product
- SKU:
- RP02804
- Additional Names:
- VEGF-C|VEGFC,Flt4-L,LMPH1D,VRP
- Extra Details:
- Vascular endothelial growth factor C (VEGF-C) is a member of the VEGF family. Upon biosynthesis, VEGF-C protein is secreted as a non-covalent momodimer in an anti-parellel fashion. VEGF-C protein is a dimeric glycoprotein, as a ligand for two receptors, VEGFR-3 (Flt4), and VEGFR-2. VEGF-C may function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis. VEGF-C protein is over-expressed in various human cancers including breast cancer and prostate cancer. VEGF-C/VEGFR-3 axis, through different signaling pathways, plays a critical role in cancer progression by regulating different cellular functions, such as invasion, proliferation, and resistance to chemotherapy. Thus, targeting the VEGF-C/VEGFR-3 axis may be therapeutically significant for certain types of tumors.
- Formulation:
- Recombinant Mouse/Rat VEGF-C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala108-Arg223) of mouse/rat VEGF-C (Accession #NP_033532.1) fused wit
- Immunogen:
- Ala108-Arg223
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02804
