Recombinant Human CTHRC1 Protein
Product Sizes
10 ug
£145.00
RP02799-10UG
20 ug
£193.00
RP02799-20UG
50 ug
£288.00
RP02799-50UG
100 ug
£431.00
RP02799-100UG
About this Product
- SKU:
- RP02799
- Additional Names:
- CTHRC1|UNQ762/PRO1550
- Extra Details:
- Recombinant Human CTHRC1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser31-Lys243) of human CTHRC1 (Accession #NP_612464.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser31-Lys243
- Molecular Weight:
- 23.92 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02799
