Recombinant Human Tenascin C/TNC Protein
Product Sizes
50 ug
£288.00
RP02798-50UG
100 ug
£395.00
RP02798-100UG
500 ug
£1157.00
RP02798-500UG
1000 ug
£1812.00
RP02798-1000UG
About this Product
- SKU:
- RP02798
- Additional Names:
- TNC, HXB, Tenascin, TN, Cytotactin, GMEM, GP 150-225, Glioma-associated-extracellular matrix antigen, Hexabrachion, JI, Myotendinous antigen, Neuronectin, Tenascin-C, TN-C
- Extra Details:
- Tenascin C/TNC is a member of the Tenascin family of extracellular matrix proteins. It is secreted as a disulfide-linked homohexamer whose subunits can vary in size from approximately 200 kDa to over 300 kDa due to differences in glycosylation. Hman Tenascin C monomer is synthesized as a precursor with a 22 amino acid (aa) signal sequence and a 2179 aa mature chai). Mature human Tenascin C (isoform 1) shares 84% aa sequence identity with mature mouse Tenascin C. In the developing embryo, Tenascin C is expressed during neural, skeletal, and vascular morphogenesis . In the adult, it virtually disappears with continued basal expression detectable only in tendon-associated tissues. However, greatup-regulation in expression occurs in tissues undergoing remodeling processes seen during wound repair and neovascularization or in pathological states such as inflammation or tumorigenesis .
- Formulation:
- Recombinant Human Tenascin C/TNC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly23-Ser621) of Human Tenascin C/TNC(Accession #NP_002151.2) fus
- Immunogen:
- Gly23-Ser621
- Molecular Weight:
- 66-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02798
