Recombinant Human AMBP Protein
Product Sizes
10 ug
£145.00
RP02794-10UG
50 ug
£288.00
RP02794-50UG
About this Product
- SKU:
- RP02794
- Additional Names:
- A1M|AMBP|EDC1|HCP|HI30|IATIL|ITI|ITIL|ITILC|UTI
- Extra Details:
- Recombinant Human AMBP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly20-Val203) of human AMBP (Accession #NP_001624.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly20-Val203
- Molecular Weight:
- 21.9 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02794
