Recombinant Human CXCL14/BRAK Protein
Product Sizes
10 ug
£145.00
RP02782-10UG
20 ug
£193.00
RP02782-20UG
About this Product
- SKU:
- RP02782
- Additional Names:
- BMAC|BRAK|CXCL14|KEC|KS1|MIP-2g|MIP2G|NJAC|SCYB14
- Extra Details:
- Recombinant Human CXCL14/BRAK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu111) of human CXCL14/BRAK (Accession #NP_004878.2) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 0.5 M NaCl, 0.5 M Arginine, pH7.4.
- Immunogen:
- Met1-Glu111
- Molecular Weight:
- 13.91 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02782
