Recombinant Mouse IL-21 Protein
Product Sizes
10 ug
£145.00
RP02775S-10UG
50 ug
£288.00
RP02775S-50UG
500 ug
£1240.00
RP02775S-500UG
1000 ug
£1954.00
RP02775S-1000UG
About this Product
- SKU:
- RP02775S
- Additional Names:
- Interleukin-21, IL-21,Il21
- Extra Details:
- IL21 belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. IL21 is expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes. It may promote the transition between innate and adaptive immunity. IL-21 has been tried as a therapy for alleviating allergic responses. It can significantly decrease pro-inflammatory cytokines produced by T cells in addition to decreasing IgE levels in a mouse model for rhinitis (nasal passage inflammation).
- Formulation:
- Recombinant Mouse IL-21 Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Ser21-Ser146) of Mouse IL-21 (Accession #NP_068554.1) fused with a His tag at
- Immunogen:
- Ser21-Ser146
- Molecular Weight:
- 18-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- SPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02775S
