Recombinant Human IFN-beta Protein
Product Sizes
100 ug
£431.00
RP02774-100UG
About this Product
- SKU:
- RP02774
- Additional Names:
- IFNB1,IFB,IFF,IFN-beta,IFNB
- Extra Details:
- Recombinant Human IFN-beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met22-Asn187) of human IFN-beta/IFNB1 (Accession #NP_002167.1) fused with C-His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 25mM NaAc PH 5.0
- Immunogen:
- Met22-Asn187
- Molecular Weight:
- 20.87 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02774
