Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling)
Product Sizes
100 ug
£657.00
RP02748B-100UG
About this Product
- SKU:
- RP02748B
- Additional Names:
- CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling) is produced by Expi293 expression system. The target protein is expressed with sequence (Gln22-Asp117(CD3E)&Phe22-Ala105(CD3D)) of Cynomolgus CD3E&CD3D fused with a hFc tag at the C-terminal.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln22-Asp117(CD3E)&Phe22-Ala105(CD3D)
- Molecular Weight:
- 36.9 kDa (CD3E), 35.4 kDa (CD3D)
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP02748B
