Recombinant Mouse NKG2-D/KLRK1/CD314 Protein
Product Sizes
10 ug
£133.00
RP02720-10UG
20 ug
£181.00
RP02720-20UG
50 ug
£240.00
RP02720-50UG
100 ug
£353.00
RP02720-100UG
500 ug
£1002.00
RP02720-500UG
1000 ug
£1574.00
RP02720-1000UG
About this Product
- SKU:
- RP02720
- Additional Names:
- CD314|D12S2489E|KLR|NKG2-D|NKG2D
- Extra Details:
- NKG2D is a type II transmembrane glycoprotein having an extracellular lectin-like domain. This domain lacks the recognizable calcium-binding sites found in true C-type lectins and binds protein rather than carbohydrate ligands. Human NKG2D is expressed on CD8 alpha beta T cells, gamma D Delta T cells, NK cells and NKT cells.
- Formulation:
- Recombinant Mouse NKG2-D/KLRK1/CD314 Protein is expressed by HEK293 cells expression system. The target protein is expressed with sequence Phe90-Val232 of NKG2D/CD314 (Accession #NP_149069.1) fused wi
- Immunogen:
- Phe90-Val232
- Molecular Weight:
- 50-60 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02720


