Recombinant Mouse NKG2-D/KLRK1/CD314 Protein
Product Sizes
10 ug
£133.00
RP02720-10UG
20 ug
£181.00
RP02720-20UG
50 ug
£240.00
RP02720-50UG
100 ug
£353.00
RP02720-100UG
About this Product
- SKU:
- RP02720
- Additional Names:
- CD314|D12S2489E|KLR|NKG2-D|NKG2D
- Extra Details:
- Recombinant Mouse NKG2-D/KLRK1/CD314 Protein is expressed by HEK293 cells expression system. The target protein is expressed with sequence Phe90-Val232 of NKG2D/CD314 (Accession #NP_149069.1) fused with a hFc at the N-terminus
- Immunogen:
- Phe90-Val232
- Molecular Weight:
- 42.38 kDa
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02720








