Recombinant Human CRTAM/CD355 (A65V) Protein
Product Sizes
10 ug
£133.00
RP02670-10UG
20 ug
£181.00
RP02670-20UG
50 ug
£240.00
RP02670-50UG
100 ug
£353.00
RP02670-100UG
500 ug
£1002.00
RP02670-500UG
1000 ug
£1574.00
RP02670-1000UG
About this Product
- SKU:
- RP02670
- Additional Names:
- CD355|CD355 antigen|CRTAM
- Extra Details:
- Class-I Restricted T Cell-Associated Molecule (CRTAM) is a protein that is expressed after T cell activation. The interaction of CRTAM with its ligand, nectin-like 2 (Necl2), is required for the efficient production of IL-17, IL-22, and IFNG Gamma by murine CD4 T cells, and it plays a role in optimal CD8 T and NK cell cytotoxicity. CRTAM promotes the pro-inflammatory cytokine profile; therefore, it may take part in the immunopathology of autoimmune diseases such as diabetes type 1 or colitis.
- Formulation:
- Recombinant Human CRTAM Protein is expressed from HEK293 cells with a His tag at the C-terminal.; It contains Ser18-Gly287.
- Immunogen:
- Ser18-Gly287
- Molecular Weight:
- 45-65 kDa
- Purity:
- ≥95%
- Sequence:
- LTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02670
