Recombinant Human IL-15RA&IL-15 Protein

Product Sizes

100 ug

£431.00

RP02654-100UG

500 ug

£1478.00

RP02654-500UG

1000 ug

£2430.00

RP02654-1000UG

About this Product

SKU:: RP02654
Additional Names:: IL-15 R alpha; CD215; IL15RA; IL-15RA; IL-15R-alpha1; Interleukin-15; IL-15; IL15
Extra Details:: Interleukin-15 receptor alpha (IL-15R alpha) is a high affinity IL-15 binding protein that is crucial for mediating IL-15 functions such as memory CD8 T cell proliferation and NK, NK/T cell, and intestinal intraepithelial lymphocyte development.
Formulation:: Recombinant Human IL-15RA&IL-15 Protein is expressed from Expi293 with His tag at the C-terminal.; It contains Ile31-Ser108(IL-15RA)&Asn49-Ser162(IL-15).
Immunogen:: Ile31-Ser108(IL-15RA)&Asn49-Ser162(IL-15)
Molecular Weight:: 26-28, 30-32 kDa
Purity:: ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
Sequence:: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket