Recombinant Cynomolgus/Rhesus macaque TNFRSF9/4-1BB Protein
Product Sizes
100 ug
£353.00
RP02643-100UG
500 ug
£1336.00
RP02643-500UG
1000 ug
£1954.00
RP02643-1000UG
About this Product
- SKU:
- RP02643
- Additional Names:
- 4-1BB|4-1BB ligand receptor|41BB|CD137|CDw137|FLJ43501|ILA|T cell antigen ILA|TNFRSF9
- Extra Details:
- 4-1BB, is also known as CD137, is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily.CD137 can be expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, CD137 expression is found on dendritic cells, B cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation.
- Formulation:
- Recombinant CynomolgusTNFRSF9/4-1BB Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Leu24-Gln186) of Cynomolgus TNFRSF9 fused with His tag at the C-ter
- Immunogen:
- Leu24-Gln186
- Molecular Weight:
- 30-40 kDa
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02643


