Recombinant Mouses LAMP5 Protein
Product Sizes
100 ug
£353.00
RP02615-100UG
500 ug
£1336.00
RP02615-500UG
1000 ug
£1954.00
RP02615-1000UG
About this Product
- SKU:
- RP02615
- Additional Names:
- BAD-LAMP|BADLAMP|C20orf103|dJ1119D9.3|LAMP-5|UNC-43
- Extra Details:
- Lysosome-associated membrane protein 5 (LAMP5) is a mammalian ortholog of the Caenorhabditis elegans protein, UNC-46, which functions as a sorting factor to localize the vesicular GABA transporter UNC-47 to synaptic vesicles. LAMP5 deficiency led to a larger intensity-dependent increase of wave I, II and V peak amplitude of auditory brainstem response. LAMP5 plays a pivotal role in sensorimotor processing in the brainstem and spinal cord.
- Formulation:
- Recombinant Mouses LAMP5 Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Glu30-Glu235.
- Immunogen:
- Glu30-Glu235
- Molecular Weight:
- 60-70 kDa
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02615
