Recombinant Mouse BAMBI Protein
Product Sizes
100 ug
£336.00
RP02614-100UG
About this Product
- SKU:
- RP02614
- Additional Names:
- Bambi|Nma
- Extra Details:
- Recombinant Mouse BAMBI Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Glu27-Ala152.
- Immunogen:
- Glu27-Ala152
- Molecular Weight:
- 40.7 kda
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02614
