Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein
Product Sizes
100 ug
£508.00
RP02529-100UG
About this Product
- SKU:
- RP02529
- Additional Names:
- Fibroblast growth factor receptor 2; FGFR-2; KGFR; K-sam; Keratinocyte growth factor receptor; CD332; BEK; KSAM
- Extra Details:
- Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro253-Glu378) of human FGFR-2 beta (IIIb)/KGFR/CD332 (Accession #P21802-3) fused with hFc tag at the C-terminus.
- Immunogen:
- Pro253-Glu378
- Molecular Weight:
- 40.5 kda
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- PHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPKQQAPGREKEITASPDYLE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP02529










