Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein
Product Sizes
100 ug
£508.00
RP02529-100UG
500 ug
£1687.00
RP02529-500UG
1000 ug
£2906.00
RP02529-1000UG
About this Product
- SKU:
- RP02529
- Additional Names:
- Fibroblast growth factor receptor 2; FGFR-2; KGFR; K-sam; Keratinocyte growth factor receptor; CD332; BEK; KSAM
- Extra Details:
- Four distinct genes encoding closely related FGF receptors, FGF R1 - 4, are known. All four genes for FGF Rs encode proteins with an N-terminal signal peptide, three immunoglobulin (Ig)-like domains, an acid-box region containing a run of acidic residues between the IgI and IgII domains, a transmembrane domain and the split tyrosine-kinase domain. Multiple forms of FGF R1 - 3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGF R1 and 2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the beta isoform.
- Formulation:
- Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro253-Glu378) of human FGFR-2 beta (III
- Immunogen:
- Pro253-Glu378
- Molecular Weight:
- 60-68 kDa
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- PHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPKQQAPGREKEITASPDYLE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP02529


