Recombinant Mouse IL-18 Protein
Product Sizes
20 ug
£193.00
RP02521-20UG
50 ug
£288.00
RP02521-50UG
About this Product
- SKU:
- RP02521
- Additional Names:
- Ig, Il-, Igif, Il-18,IL18
- Extra Details:
- Recombinant Mouse IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn36-Ser192) of Mouse IL-18 fused with His tag at the C-terminus
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 8.0.
- Immunogen:
- Asn36-Ser192
- Molecular Weight:
- 18.96 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02521








