Recombinant Mouse IL-1 alpha Protein
Product Sizes
10 ug
£145.00
RP02518-10UG
20 ug
£193.00
RP02518-20UG
50 ul
£288.00
RP02518-50UL
100 ul
£431.00
RP02518-100UL
About this Product
- SKU:
- RP02518
- Additional Names:
- Il1a , Interleukin-1 alpha, IL-1 alpha
- Extra Details:
- Recombinant Mouse IL-1 alpha Protein is produced by E. coli cells expression system. The target protein is expressed with sequence (Ser115-Ser270) of Mouse IL-1 alpha(Accession # P01582) fused with No tag .
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4).
- Immunogen:
- Ser115-Ser270
- Molecular Weight:
- 17.99 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02518
