Recombinant Human Mature BMP-7 Protein
Product Sizes
10 ug
£223.00
RP02513S-10UG
20 ug
£318.00
RP02513S-20UG
50 ug
£478.00
RP02513S-50UG
100 ug
£734.00
RP02513S-100UG
500 ug
£2192.00
RP02513S-500UG
1000 ug
£3478.00
RP02513S-1000UG
About this Product
- SKU:
- RP02513S
- Additional Names:
- BMP7, OP1,Bone morphogenetic protein 7, BMP-7, Osteogenic protein 1, OP-1, Eptotermin alfa
- Extra Details:
- BMP-7 (Bone morphogenetic protein 7) is a bone morphogenetic protein which belongs to the TGF-B Beta superfamily. OP-1 is expressed in the brain, kidneys, and bladder. BMP-7 may be involved in bone homeostasis and plays a key role in the transformation of mesenchymal cells into bone and cartilage. The phosphorylation of SMAD1 and SMAD5 can be induced by BMP-7, which in turn induce transcription of numerous osteogenic genes. BMP-7 treatment can also induce all of the genetic markers of osteoblast differentiation in many cell types. Human recombinant BMP-7 protein can be used to aid in the fusion of vertebral bodies to prevent neurologic trauma. It also functions in the treatment of tibial non-union, frequently in cases where a bone graft has failed. It is found that BMP7 has the potential for treatment of chronic kidney disease.
- Formulation:
- Recombinant Human BMP-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser293-His431) of Human BMP-7(Accession #NP_001710.1) fused with No Tag.
- Immunogen:
- Ser293-His431
- Molecular Weight:
- 15-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02513S
