Recombinant Human Mature BMP-7 Protein
Product Sizes
10 ug
£223.00
RP02513S-10UG
20 ug
£318.00
RP02513S-20UG
50 ug
£478.00
RP02513S-50UG
100 ug
£734.00
RP02513S-100UG
About this Product
- SKU:
- RP02513S
- Additional Names:
- BMP7, OP1,Bone morphogenetic protein 7, BMP-7, Osteogenic protein 1, OP-1, Eptotermin alfa
- Extra Details:
- Recombinant Human BMP-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser293-His431) of Human BMP-7(Accession #NP_001710.1) fused with No Tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM acetic acid, pH3.6.
- Immunogen:
- Ser293-His431
- Molecular Weight:
- 15.68 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02513S
