Recombinant Human/Mouse/Rat Mature BMP-4 Protein
Product Sizes
10 ug
£223.00
RP02512S1-10UG
20 ug
£318.00
RP02512S1-20UG
50 ug
£478.00
RP02512S1-50UG
100 ug
£734.00
RP02512S1-100UG
About this Product
- SKU:
- RP02512S1
- Additional Names:
- BMP4, BMP2B, DVR4,Bone morphogenetic protein 4, BMP-4, Bone morphogenetic protein 2B, BMP-2B
- Extra Details:
- Recombinant Human/Mouse/Rat Mature BMP-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser293-Arg408) of Human Mature BMP-4 (Accession #NP_001193.2) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM acetic acid,pH3.6.
- Immunogen:
- Ser293-Arg408
- Molecular Weight:
- 13.13 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02512S1
