Recombinant Human/Mouse/Rat Mature BMP-4 Protein
Product Sizes
10 ug
£223.00
RP02512S1-10UG
20 ug
£318.00
RP02512S1-20UG
50 ug
£478.00
RP02512S1-50UG
100 ug
£734.00
RP02512S1-100UG
500 ug
£2192.00
RP02512S1-500UG
1000 ug
£3478.00
RP02512S1-1000UG
About this Product
- SKU:
- RP02512S1
- Additional Names:
- BMP4, BMP2B, DVR4,Bone morphogenetic protein 4, BMP-4, Bone morphogenetic protein 2B, BMP-2B
- Extra Details:
- Recombinant Human/Mouse/Rat Mature BMP-4 Protein that in humans is encoded by BMP4 gene. BMP4 is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. BMP4 is highly conserved evolutionarily. BMP4 is found in early embryonic development in the ventral marginal zone and in the eye, heart blood and otic vesicle.
- Formulation:
- Recombinant Human/Mouse/Rat Mature BMP-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser293-Arg408) of Human Mature BMP-4 (Accession #NP_00119
- Immunogen:
- Ser293-Arg408
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02512S1
