Recombinant Human Siglec-6/CD327 Protein
Product Sizes
20 ug
£175.00
RP02493-20UG
About this Product
- SKU:
- RP02493
- Additional Names:
- SIGLEC6, CD33L, CD33L1, OBBP1,Sialic acid-binding Ig-like lectin 6, Siglec-6, CD33 antigen-like 1, CDw327, Obesity-binding protein 1, OB-BP1, CD327
- Extra Details:
- Recombinant Human Siglec-6/CD327 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln27-Val331) of Human Siglec-6/CD327 (Accession #NP_942142.3) fused with a hFc and His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln27-Val331
- Molecular Weight:
- 58.31 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP02493
