Recombinant Cynomolgus CD3 epsilon/CD3E Protein
Product Sizes
100 ug
£395.00
RP02318-100UG
500 ug
£1413.00
RP02318-500UG
1000 ug
£2258.00
RP02318-1000UG
About this Product
- SKU:
- RP02318
- Additional Names:
- CD3,CD3-DELTA,T3D,CD3E, CD3E
- Extra Details:
- Recombinant Cynomolgus CD3 Epsilon Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Gln22-Asp117) of Cynomolgus CD3 Epsilon fused with a hFc tag at the C-terminal.
- Formulation:
- Recombinant Cynomolgus CD3 Epsilon Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Gln22-Asp117) of Cynomolgus CD3 Epsilon fused with a hFc tag at the
- Immunogen:
- Gln22-Asp117
- Molecular Weight:
- 43-48 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02318


