Recombinant Mouse TNFRSF17/BCMA/CD269 Protein
Product Sizes
100 ug
£353.00
RP02288-100UG
500 ug
£1336.00
RP02288-500UG
1000 ug
£1954.00
RP02288-1000UG
About this Product
- SKU:
- RP02288
- Additional Names:
- CD269 antigen, CD269, TNFRSF17, B cell maturation antigen, B-cell maturation protein, BCMA, BCMA tumor necrosis factor receptor superfamily member 17, BCMB-cell maturation factor, tumor necrosis factor receptor superfamily, member 17
- Extra Details:
- Recombinant Mouse BCMA Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Met1-Thr49) of Mouse BCMA fused with hFc tag at the C-terminal.
- Formulation:
- Recombinant Mouse BCMA Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Met1-Thr49) of Mouse BCMA fused with hFc tag at the C-terminal.
- Immunogen:
- Met1-Thr49
- Molecular Weight:
- 38-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequence:
- MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02288


