Recombinant Human Prostate stem cell antigen/PSCA Protein
Product Sizes
10 ug
£145.00
RP02245-10UG
20 ug
£193.00
RP02245-20UG
About this Product
- SKU:
- RP02245
- Additional Names:
- PSCA,PRO232
- Extra Details:
- Recombinant Human Prostate stem cell antigen/PSCA Protein is produced by HEK293 cells expression system. The target protein is expressed with Prostate stem cell antigen/PSCA(Leu12-Ser86) fused with a His Tag at the C-terminal. .
- Formulation:
- Lyophilized from sterile PBS, pH 7.4. Normally 5 % - 66 % trehalose is added as protectants before lyophilization.
- Immunogen:
- Leu12-Ser86
- Molecular Weight:
- 9.06 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02245




