Recombinant Human Prostate stem cell antigen/PSCA Protein

Product Sizes

10 ug

£145.00

RP02245-10UG

20 ug

£193.00

RP02245-20UG

50 ug

£288.00

RP02245-50UG

100 ug

£431.00

RP02245-100UG

500 ug

£1240.00

RP02245-500UG

1000 ug

£1954.00

RP02245-1000UG

About this Product

SKU:: RP02245
Additional Names:: PSCA,PRO232
Extra Details:: This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
Formulation:: Recombinant Human Prostate stem cell antigen/PSCA Protein is produced by HEK293 cells expression system. The target protein is expressed with Prostate stem cell antigen/PSCA(Leu12-Ser86) fused with a
Immunogen:: Leu12-Ser86
Molecular Weight:: 15-35 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket