Recombinant Human Prostate stem cell antigen/PSCA Protein
Product Sizes
10 ug
£145.00
RP02245-10UG
20 ug
£193.00
RP02245-20UG
50 ug
£288.00
RP02245-50UG
100 ug
£431.00
RP02245-100UG
500 ug
£1240.00
RP02245-500UG
1000 ug
£1954.00
RP02245-1000UG
About this Product
- SKU:
- RP02245
- Additional Names:
- PSCA,PRO232
- Extra Details:
- This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
- Formulation:
- Recombinant Human Prostate stem cell antigen/PSCA Protein is produced by HEK293 cells expression system. The target protein is expressed with Prostate stem cell antigen/PSCA(Leu12-Ser86) fused with a
- Immunogen:
- Leu12-Ser86
- Molecular Weight:
- 15-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02245
