Recombinant Mouse CD3E&CD3D Protein
Product Sizes
100 ug
£508.00
RP02215-100UG
About this Product
- SKU:
- RP02215
- Additional Names:
- CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
- Extra Details:
- Recombinant Mouse CD3E&CD3D Heterodimer Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp23-Asp108(P22646)&Phe22-Ala105(P04235)) of mouse CD3E&CD3D (Accession #) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4). Normally 5 % trehalose is added as protectant before lyophilization.
- Immunogen:
- Asp23-Asp108(P22646)&Phe22-Ala105(P04235)
- Molecular Weight:
- 36.1 kDa (CD3E), 35.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by Tris-Bis PAGE.≥ 95 %
- Sequence:
- DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02215
