Recombinant Mouse TNFRSF18/GITR/CD357 Protein
Product Sizes
10 ug
£145.00
RP02184-10UG
50 ug
£288.00
RP02184-50UG
About this Product
- SKU:
- RP02184
- Additional Names:
- AITR, Gitr, Tnfrsf18
- Extra Details:
- Recombinant Mouse TNFRSF18/GITR/CD357 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ser22-His153) of mouse GITR (Accession #O35714) fused with an Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser22-His153
- Molecular Weight:
- 42.3 kda
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02184
