Recombinant Human FAM3B/PANDER Protein
Product Sizes
50 ug
£ POA
RP02181-50UG
10 ug
£145.00
RP02181-10UG
500 ug
£1478.00
RP02181-500UG
1000 ug
£2430.00
RP02181-1000UG
About this Product
- SKU:
- RP02181
- Additional Names:
- FAM3B,2-21,C21orf11,C21orf76,ORF9,PANDER,PRED44
- Extra Details:
- FAM3B, also known as Pancreatic-derived factor (PANDER), is an islet-specific secreted cytokine specifically expressed at high levels in the islets of Langerhans of the endocrine pancreas. FAM3B can induce apoptosis of alpha and beta cells in a dose- and time-dependent manner. Previous studies showed that FAM3B regulates glucose and lipid metabolism through interaction with liver and endocrine pancreas. FAM3B silencing activates both extrinsic and intrinsic apoptotic pathways. In general, silencing FAM3B promoted p53 phosphorylation and induced p53 accumulation by decreasing Mdm2 expression, which resulted in apoptotic cell death.
- Formulation:
- Recombinant Human FAM3B/PANDER Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Glu30-Ser235) of human FAM3B (Accession #P58499) fused with an Fc tag
- Immunogen:
- Glu30-Ser235
- Molecular Weight:
- 50-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02181
