Recombinant Human FAM3B/PANDER Protein
Product Sizes
10 ug
£145.00
RP02181-10UG
50 ug
£336.00
RP02181-50UG
About this Product
- SKU:
- RP02181
- Additional Names:
- FAM3B,2-21,C21orf11,C21orf76,ORF9,PANDER,PRED44
- Extra Details:
- Recombinant Human FAM3B/PANDER Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Glu30-Ser235) of human FAM3B (Accession #P58499) fused with an Fc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Glu30-Ser235
- Molecular Weight:
- 50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02181
