Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein
Product Sizes
10 ug
£133.00
RP02179-10UG
20 ug
£181.00
RP02179-20UG
50 ug
£240.00
RP02179-50UG
100 ug
£353.00
RP02179-100UG
About this Product
- SKU:
- RP02179
- Additional Names:
- ANGPTL4,ARP4,FIAF,HARP,HFARP,NL2,PGAR,TGQTL,UNQ171,pp1158
- Extra Details:
- Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Pro166-Ser406) of human ANGPTL4 (Accession #Q9BY76) fused with a 6xHis tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Pro166-Ser406
- Molecular Weight:
- 27.92 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02179
