Recombinant Human FABP2/I-FABP Protein
Product Sizes
10 ug
£127.00
RP02173S-10UG
20 ug
£157.00
RP02173S-20UG
50 ug
£223.00
RP02173S-50UG
100 ug
£336.00
RP02173S-100UG
500 ug
£907.00
RP02173S-500UG
1000 ug
£1478.00
RP02173S-1000UG
About this Product
- SKU:
- RP02173S
- Additional Names:
- FABP2, FABPI,Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein, I-FABP
- Extra Details:
- FABP2/I-FABP,FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
- Formulation:
- Recombinant Recombinant Human FABP2/I-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Asp132) of Human FABP2/I-FABP (Accession #NP_00012
- Immunogen:
- Ala2-Asp132
- Molecular Weight:
- 15-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02173S
