Recombinant Human VSIG8 Protein
Product Sizes
10 ug
£145.00
RP02169-10UG
50 ug
£336.00
RP02169-50UG
500 ug
£2050.00
RP02169-500UG
1000 ug
£2430.00
RP02169-1000UG
About this Product
- SKU:
- RP02169
- Additional Names:
- VSIG8, C1orf204, VSIG8
- Extra Details:
- V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The human VSIG8 cDNA encodes 414 amino acids (aa) including a 21 aa signal sequence, a 242 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 130 aa cytoplasmic domain.The funtion of VSIG8 is not clear.
- Formulation:
- Recombinant Human VSIG8 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Val22-Gly263) of human VSIG8 (Accession #Q5VU13) fused with a 6xHis tag at th
- Immunogen:
- Val22-Gly263
- Molecular Weight:
- 28-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02169
