Recombinant Human SLAMF5/CD84 Protein
Product Sizes
10 ug
£133.00
RP02164-10UG
20 ug
£181.00
RP02164-20UG
100 ug
£353.00
RP02164-100UG
500 ug
£1002.00
RP02164-500UG
1000 ug
£1574.00
RP02164-1000UG
About this Product
- SKU:
- RP02164
- Additional Names:
- CD84, LY9B, SLAMF5, hCD84, mCD84, CD84 molecule,LY9B,SLAMF5,hCD84,mCD84
- Extra Details:
- SLAM family member 5 (SLAMF5/CD84) is a type I transmembrane protein in the SLAM subgroup of the CD2 family. SLAM family proteins regulate multiple aspects of immune system function. Mature human CD84 consists of a 204 amino acid (aa) extracellular domain (ECD) with two Iglike domains,a 21 aa transmembrane segment, and a 99 aa cytoplasmic domain with two immunoreceptor tyrosinebased switch motifs (ITSMs). CD84 exhibits homophilic binding which is mediated by the N-terminal Ig-like domain. Ligation induces tyrosine phosphorylation in the cytoplasmic ITSMs which then recruit the signaling adaptor molecules SAP (SLAM-associated protein) and EAT-2(EWS/Fli1-activated transcript 2).CD84 signaling inhibits Fc epsilon RI-induced mast cell activation but enhances platelet activation. LPS-induced macrophage activation,T cell proliferation and IFN-G Gammaproduction, and the interactions between T cells and B cells that are required for germinal center formation.
- Formulation:
- Recombinant Human SLAMF5/CD84 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Lys22-Arg220) of human SLAMF5 (Accession #Q9UIB8) fused with a 6xHis ta
- Immunogen:
- Lys22-Arg220
- Molecular Weight:
- 40-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02164
