Recombinant Human SLAMF5/CD84 Protein
Product Sizes
10 ug
£133.00
RP02164-10UG
20 ug
£181.00
RP02164-20UG
100 ug
£353.00
RP02164-100UG
About this Product
- SKU:
- RP02164
- Additional Names:
- CD84, LY9B, SLAMF5, hCD84, mCD84, CD84 molecule,LY9B,SLAMF5,hCD84,mCD84
- Extra Details:
- Recombinant Human SLAMF5/CD84 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Lys22-Arg220) of human SLAMF5 (Accession #Q9UIB8) fused with a 6xHis tag at the C- terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Lys22-Arg220
- Molecular Weight:
- 23.09 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02164




