Recombinant Human Decorin/PG-S2/DCN Protein
Product Sizes
10 ug
£115.00
RP02157-10UG
20 ug
£145.00
RP02157-20UG
50 ug
£193.00
RP02157-50UG
100 ug
£276.00
RP02157-100UG
About this Product
- SKU:
- RP02157
- Additional Names:
- DCN,CSCD,DSPG2,PG40,PGII,PGS2,SLRR1B,decorin,Decorin
- Extra Details:
- Recombinant Human Decorin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp31-Lys359) of human Decorin (Accession #P07585) fused with a hFC tag at the C- terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Asp31-Lys359
- Molecular Weight:
- 62.29 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02157
