Recombinant Human Decorin/PG-S2/DCN Protein
Product Sizes
10 ug
£115.00
RP02157-10UG
20 ug
£145.00
RP02157-20UG
50 ug
£193.00
RP02157-50UG
100 ug
£276.00
RP02157-100UG
500 ug
£764.00
RP02157-500UG
1000 ug
£1193.00
RP02157-1000UG
About this Product
- SKU:
- RP02157
- Additional Names:
- DCN,CSCD,DSPG2,PG40,PGII,PGS2,SLRR1B,decorin,Decorin
- Extra Details:
- Decorin is a secreted chondroitin/dermatan sulfate proteoglycan in the family of small leucine-rich proteoglycans (SLRPs). SLRP family members are characterized by N-terminal and C-terminal cysteine-rich regions which flank the central region containing 10-12 tandem leucine-rich repeats (LRR). The human Decorin cDNA encodes a 359 amino acid (aa) precursor that includes a 16 aa signal sequence and a 14 aa propeptide. Alternate splicing of human Decorin generates five isoforms with variable length deletions. Decorin is an N-glycosylated protein that also carries a variablysized hybrid chondroitin/dermatan sulfate chain at Ser34. Decorin regulates assembly of the extracellular collagen matrix and the bioactivity of the matrix associated growth factors FGF2,GDF8/Myostatin, TGFB Beta,and WISP1. It also binds and activates EGF R, ErbB4, and IGFI-R. In vivo, Decorin promotes myoblast differentiation, supports angiogenesis, and inhibits tumor progression.
- Formulation:
- Recombinant Human Decorin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp31-Lys359) of human Decorin (Accession #P07585) fused with a hFC tag
- Immunogen:
- Asp31-Lys359
- Molecular Weight:
- 65-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02157
