Recombinant Human CEACAM8/CD66b Protein
Product Sizes
10 ug
£133.00
RP02155-10UG
20 ug
£181.00
RP02155-20UG
50 ug
£240.00
RP02155-50UG
100 ug
£353.00
RP02155-100UG
500 ug
£1002.00
RP02155-500UG
1000 ug
£1574.00
RP02155-1000UG
About this Product
- SKU:
- RP02155
- Additional Names:
- CEACAM8,CD66b,CD67,CGM6,NCA-95
- Extra Details:
- Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) is a single chain, GPI-anchored, highly glycosylated protein which belongs to the immunoglobulin superfamily and the carcinoembryonic antigen(CEA) family. CEACAM8 is expressed by neutrophils and eosinophils, and serves as a binding partner for CEACAM-6 and Galectin-3. It contains two Ig-like C2-type (immunoglobulin-like) domains and one Ig-like V-type (immunoglobulin-like) domain. Mature human CEACAM8 is a 287 amino acid GPI-linked glycoprotein. CEACAM family members are a set of widely expressed proteins involved in several biological functions, including cell adhesion, migration, signal transduction, and the regulation of gene expression. Abnormal overexpression and downregulation of some CEACAMs have been described in tumor cells.
- Formulation:
- Recombinant Human CEACAM8/CD66b Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln35-Ser319) of human CEACAM8 (Accession #P31997) fused with a hFC t
- Immunogen:
- Gln35-Ser319
- Molecular Weight:
- 75-100 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02155
