Recombinant Human BTN3A2 Protein
Product Sizes
10 ug
£193.00
RP02153-10UG
50 ug
£478.00
RP02153-50UG
About this Product
- SKU:
- RP02153
- Additional Names:
- BT3.2, BTF4, BTN3.2, CD277, BTN3A2
- Extra Details:
- Recombinant Human BTN3A2 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln30-Trp248) of human BTN3A2 (Accession #P78410) fused with a 6xHis tag at the C- terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln30-Trp248
- Molecular Weight:
- 24.6 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02153
