Recombinant Human CADM3/IGSF4B Protein
Product Sizes
10 ug
£145.00
RP02145-10UG
50 ug
£336.00
RP02145-50UG
500 ug
£2050.00
RP02145-500UG
1000 ug
£2430.00
RP02145-1000UG
About this Product
- SKU:
- RP02145
- Additional Names:
- CADM3,BIgR,IGSF4B,NECL1,Necl-1,TSLL1,synCAM3
- Extra Details:
- Cell Adhesion Molecular Proteins are proteins located on the cell surface involved with the binding with other cells or with the extracellular matrix in the cell adhesion process. These proteins consists of three domains, an transmembrane domain, an intracellular domain that interacts with the cytoskeleton, and an extracellular domain that interacts with other CAMs of the same kind or with other CAMs or the extracellular matrix. Cell Adhesion Molecular 3 (CADM3) is a neural tissue-specific member of the nectin- like family of immunoglobulin superfamily. CADM3 interacts with EPB41L1 may regulate structure or function of cell-cell junctions. CADM3 has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3.
- Formulation:
- Recombinant Human CADM3/IGSF4B Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asn25-His330) of human CADM3 (Accession #Q8N126) fused with a 6xHis ta
- Immunogen:
- Asn25-His330
- Molecular Weight:
- 35-42 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02145
