Recombinant Human TMPO Protein
Product Sizes
10 ug
£145.00
RP02141-10UG
50 ug
£336.00
RP02141-50UG
About this Product
- SKU:
- RP02141
- Additional Names:
- TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP, thymopoietin,CMD1T,LAP2,LEMD4,PRO0868,TP
- Extra Details:
- Recombinant Human TMPO Protein is produced by E.coli expression system. The target protein is expressed with sequence (Pro2-Glu187) of human TMPO (Accession #P42167) fused with a 6xHis tag at the C- terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Pro2-Glu187
- Molecular Weight:
- 21.6 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02141
