Recombinant Human TMPO Protein
Product Sizes
10 ug
£145.00
RP02141-10UG
50 ug
£336.00
RP02141-50UG
500 ug
£2050.00
RP02141-500UG
1000 ug
£2430.00
RP02141-1000UG
About this Product
- SKU:
- RP02141
- Additional Names:
- TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP, thymopoietin,CMD1T,LAP2,LEMD4,PRO0868,TP
- Extra Details:
- Thymopentin is a member of the LEM family. Thymopentin is expressed in many tissues, highly in the adult thymus and fetal liver. The N-terminal contains two structurally independent domains, LEM domain and LEM-like domain. The C-terminal domain forms a four-stranded coiled coil. Thymopentin may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It is associated with T-cell development and function. Meantime, Thymopentin plays an important role, together with LMNA, in the nuclear anchorage of RB1. Thymopoietin is participated in the induction of CD90 in the thymus.
- Formulation:
- Recombinant Human TMPO Protein is produced by E.coli expression system. The target protein is expressed with sequence (Pro2-Glu187) of human TMPO (Accession #P42167) fused with a 6xHis tag at the C- t
- Immunogen:
- Pro2-Glu187
- Molecular Weight:
- 27 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02141
