Recombinant Human PRL-2 Protein
Product Sizes
10 ug
£145.00
RP02140-10UG
50 ug
£336.00
RP02140-50UG
About this Product
- SKU:
- RP02140
- Additional Names:
- PTP4A2,HH13,HH7-2,HU-PP-1,OV-1,PRL-2,PRL2,PTP4A,PTPCAAX2,ptp-IV1a,ptp-IV1b
- Extra Details:
- Recombinant Human PRL-2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Gln167) of human PRL2 (Accession #Q12974) fused with a 6xHis tag at the C- terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM HEPES, 150mM NaCl, 10mM B Beta-ME, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Gln167
- Molecular Weight:
- 20.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP02140
