Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Recombinant Human/Mouse/Rat HMGB1 Box1 Protein

Product Sizes
10 ug
£145.00
RP02132-10UG
50 ug
£336.00
RP02132-50UG
500 ug
£1478.00
RP02132-500UG
1000 ug
£2430.00
RP02132-1000UG
About this Product
SKU:
RP02132
Additional Names:
BoxA|High Mobility Group Protein 1|High Mobility Group Protein B1|HMG-1|HMG1|HMGB1
Extra Details:
High-mobility group box 1 protein (HMGB1), also known as HMG-1 or amphoterin previously, is a member of the HMGB family consisting of three members, HMGB1, HMGB2, and HMGB3. HMGB1 is a DNA-binding nuclear protein, released actively following cytokine stimulation as well as passively during cell death. It is the prototypic damage-associated molecular pattern (DAMP) molecule and has been implicated in several inflammatory disorders. HMGB1 signals via the receptor for advanced glycation end-product (RAGE) and members of the toll-like receptor (TLR) family. The most prominent HMGB1 protein and mRNA expression arthritis are present in pannus regions, where synovial tissue invades articular cartilage and bone. HMGB1 promotes the activity of proteolytic enzymes, and osteoclasts need HMGB1 for functional maturation. As a non-histone nuclear protein, HMGB1 has a dual function. Inside the cell, HMGB1 binds DNA, regulating transcription, and determining chromosomal architecture. Outside the cell, HMGB1 can serve as an alarmin to activate the innate system and mediate a wide range of physiological and pathological responses. Extracellular HMGB1 represents an optimal " necrotic marker" selected by the innate immune system to recognize tissue damage and initiate reparative responses. However, extracellular HMGB1 also acts as a potent pro-inflammatory cytokine that contributes to the pathogenesis of diverse inflammatory and infectious disorders. HMGB1 has been successfully therapeutically targeted in multiple preclinical models of infectious and sterile diseases including arthritis. As shown in studies on patients as well as animal models, HMGB1 can play an important role in the pathogenesis of the rheumatic disease, including rheumatoid arthritis, systemic lupus erythematosus, and polymyositis among others. Besides, enhanced postmyocardial infarction remodeling in type 1 diabetes mellitus was partially mediated by HMGB1 activation.
Formulation:
Recombinant Human/Mouse/Rat HMGB1 Box1 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Phe89) of Human/Mouse/Rat HMGB1 Box1 (Accession #P09429/P631
Immunogen:
Met1-Phe89
Molecular Weight:
14 kDa
Physical State:
Lyophilized
Purity:
≥95%
Sequence:
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
ABclonal Technology
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins