Recombinant Human/Mouse/Rat HMGB1 Box1 Protein
Product Sizes
10 ug
£145.00
RP02132-10UG
50 ug
£336.00
RP02132-50UG
About this Product
- SKU:
- RP02132
- Additional Names:
- BoxA|High Mobility Group Protein 1|High Mobility Group Protein B1|HMG-1|HMG1|HMGB1
- Extra Details:
- Recombinant Human/Mouse/Rat HMGB1 Box1 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Phe89) of Human/Mouse/Rat HMGB1 Box1 (Accession #P09429/P63158/P63159) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50 mM HEPES, 500 mM NaCl, 0.5 mM DTT, pH 7.9. Contact us for customized product form or formulation.
- Immunogen:
- Met1-Phe89
- Molecular Weight:
- 10.4 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02132
