Recombinant Human CXCL16/SR-PSOX Protein
Product Sizes
10 ug
£133.00
RP02131-10UG
20 ug
£181.00
RP02131-20UG
50 ug
£240.00
RP02131-50UG
100 ug
£353.00
RP02131-100UG
About this Product
- SKU:
- RP02131
- Additional Names:
- CXCL16, SCYB16, SRPSOX, UNQ2759/PRO6714,C-X-C motif chemokine 16, Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein, SR-PSOX, Small-inducible cytokine B16, Transmembrane chemokine CXCL16
- Extra Details:
- Recombinant Human CXCL16/SR-PSOX Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Thr205) of Human CXCL16/SR-PSOX Protein (Accession #NP_001094282.1) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Thr205
- Molecular Weight:
- 19.9 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSAT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02131
